PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0253s0017.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family Whirly
Protein Properties Length: 271aa    MW: 29824.4 Da    PI: 10.1853
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0253s0017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly161.91.7e-50922282138
                Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkv 90 
                            yk+k+al++ +++p fe +++g ++++r+G+l+le+a+++++++ydW++kq  +ls+ e++ l++l + es effhdp +++s++Gkv
  Sphfalx0253s0017.1.p  92 FYKGKGALSLRPKKPVFEVIEAGGVTVSREGSLFLEFAPSVGPKTYDWSRKQIISLSVLELGRLLELQAGESVEFFHDPNMGKSEQGKV 180
                           6**************************************************************************************** PP

                Whirly  91 rkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                           rk+l++eP+pd +G+f+nl+v n++v  +++ +vP+ kaefav+rsl+
  Sphfalx0253s0017.1.p 181 RKSLRIEPIPDKTGYFFNLTVANKIVGFEDRQMVPIMKAEFAVMRSLM 228
                           *********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.9E-6483248IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544476.98E-5484249IPR009044ssDNA-binding transcriptional regulator
PfamPF085369.2E-5393227IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MLKMIGFQKH AAMAWGVSTR ELVGGGLRQL GSFAGGSSSS DGTSIRWRRR QHWQQIAMRP  60
SPRCVTFSTS VAGMSQPSGA LPYGKVYVNY TFYKGKGALS LRPKKPVFEV IEAGGVTVSR  120
EGSLFLEFAP SVGPKTYDWS RKQIISLSVL ELGRLLELQA GESVEFFHDP NMGKSEQGKV  180
RKSLRIEPIP DKTGYFFNLT VANKIVGFED RQMVPIMKAE FAVMRSLMNY LIPHLLGWQV  240
FVDPSQLDDS MFGGEQGMTA GAVGVSEWAK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A2e-598526237214p24: plant transcriptional regulator PBF-2
1l3a_B2e-598526237214p24: plant transcriptional regulator PBF-2
1l3a_C2e-598526237214p24: plant transcriptional regulator PBF-2
1l3a_D2e-598526237214p24: plant transcriptional regulator PBF-2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.26e-52ssDNA-binding transcriptional regulator